Protein Labeling Reagents
Biotium CD63 (Late Endosomes Marker) (LAMP3/2990R), Biotin conjugate, 0.1mg/mL
This MAb recognizes protein of 26 kDa-60 kDa, which is identified as CD63. Its epitope is different from that of MAb LAMP3/529. The tetraspanins are integral membrane proteins expressed on cell surface and granular membranes of hematopoietic cells and are components of multi-molecular complexes with specific integrins. The tetraspanin CD63 is a lysosomal membrane glycoprotein that translocates to the plasma membrane after platelet activation. CD63 is expressed on activated platelets, monocytes and macrophages, and is weakly expressed on granulocytes, T cell and B cells. It is located on the basophilic granule membranes and on the plasma membranes of lymphocytes and granulocytes. CD63 is a member of the TM4 superfamily of leukocyte glycoproteins that includes CD9, CD37 and CD53, which contain four transmembrane regions. CD63 may play a role in phagocytic and intracellular lysosome-phagosome fusion events. CD63 deficiency is associated with Hermansky-Pudlak syndrome and is strongly
Medchemexpress LLC Desthiobiotin-PEG4-acid | >98% | 461.55 | 25 MG
Desthiobiotin-PEG4-acid is a PEG-based PROTAC linker that can be used in the synthesis of PROTACs. PROTACs contain two different ligands connected by a linker; one is a ligand for an E3 ubiquitin ligase and the other is for the target protein. PROTACs exploit the intracellular ubiquitin-proteasome system to selectively degrade target proteins.
- Used as a PEG-based PROTAC linker
- Useful in the synthesis of PROTACs
- Enables selective degradation of target proteins
Life Tein LLC Phospha Oseltamivir Biotin Conjugate, 1 mg, Solid powder, Purity >90%, Low water solubility, Soluble in DMSO, Undecaethylene glycol spacer
Phospha Oseltamivir Biotin Conjugate (1 mg) is a specialized molecular tool designed for advanced research and drug development related to the influenza virus. It combines phosphate-oseltamivir, a potent influenza neuraminidase (NA) inhibitor, with d-biotin, facilitating its application in diagnostic assays and vaccine development. The compound's robust stability on streptavidin-coated biosensors ensures its efficacy in selective influenza virus immobilization, providing critical insights into viral activity and resistance mechanisms.
- Retains strong inhibitory action against influenza neuraminidase
- Facilitates interaction with avidin or streptavidin detection systems
- Low water solubility; soluble in DMSO or DMF
- Very stable on streptavidin-coated biosensors
- Useful in influenza diagnosis and drug discovery
Medchemexpress LLC HY-111377 5mg Medchemexpress, Amine-PEG3-Biotin CAS:359860-27-8 Purity:>98%
Medchemexpress, HY-111377 5mg Amine-PEG3-Biotin CAS:359860-27-8 Amine-PEG3-Biotin is used as a signal amplification label. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Revvity Health Sciences Inc IVISense 750 MAL Fluorescent Self-Quenching Dye (5 mg) (VivoTag)
IVISense 750 MAL Fluorescent Self-Quenching Dye (5 mg) (VivoTag)
Apexbio Technology LLC Cyclo (-RGDfK), 5mg. Cas: 161552-03-0 MFCD: MFCD00937400. Inhibitor of αvβ3 integrin
In one study where this peptide was labeled with 125I, it was found to bind specifically and with high affinity to v3 receptors on neovascular blood vessel sections of different major human cancers. The integrin alpha(IIb)beta(3)-specific cyclic hexapeptide contains an Arg-Gly-Asp (RGD) sequence. Other sizes are available. Please inqury us for quote.
Medchemexpress LLC Cyanine5 NHS ester (iodide) | 00-00-0 | 98.0% | C36H42IN3O4 | 10MG
Cyanine5 NHS ester iodide is an amine-reactive, red-emitting fluorescent dye for covalent labeling of primary amino groups in peptides, proteins, and oligonucleotides. Supplied as a solid NHS-ester with an iodide counter-ion, it is characterized for research use with COA, SDS, HNMR, and LCMS documentation to support conjugation and analytical workflows.
- Red emission suitable for near-infrared fluorescence detection.
- Amine-reactive NHS ester for covalent labeling of primary amines.
- High purity supporting consistent conjugation performance.
- Available in multiple small-scale pack sizes for research use.
- Characterized by COA, HNMR, and LCMS documentation.
CPC Scientific TAMRA-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-OH (trifluoroacetate salt) 0.1MG
Synthetic peptide that forms fibrils with have the same antigenic and structural features as those of native AD amyloid filaments.ONE-LETTER SEQUENCE: TAMRA-DAEFRHDSGYEVHHQKLVFFAEDVGSNKMOLECULAR FORMULA: C170H230N43O50MOLECULAR WEIGHT:3676STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [109770-29-8], RESEARCH AREA: Alzheimer's DiseaseREFERENCES: J. Kang et al., Nature, 325, 773 (1987)
CPC Scientific TAMRA-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-OH (trifluoroacetate salt) 0.5MG
Synthetic peptide that forms fibrils with have the same antigenic and structural features as those of native AD amyloid filaments.ONE-LETTER SEQUENCE: TAMRA-DAEFRHDSGYEVHHQKLVFFAEDVGSNKMOLECULAR FORMULA: C170H230N43O50MOLECULAR WEIGHT:3676STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [109770-29-8], RESEARCH AREA: Alzheimer's DiseaseREFERENCES: J. Kang et al., Nature, 325, 773 (1987)
Revvity Health Sciences Inc IVISense Cat K 680 FAST Fluorescent Probe
IVISense Cat K 680 FAST Fluorescent Probe